Recombinant Human T cell receptor beta variable 10-2 (TVBJ2)
This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
T cell receptor beta variable 10-2 TRBV10-2
UniProt
A0A0K0K1G8
Expression Region
22-114
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ISTOC1268 5x 125 mL
Reagecon Validation Kit to NIST Sucrose for Total Organic Carbon (TOC) suitable for use with Lighthouse Analyser
Sign In for Pricing
View Details 