Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2)

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apelin Receptor Antibody FITC
MBS5400326-01 0.1 mg

Apelin Receptor Antibody FITC

Sign In for Pricing
View Details
Apelin Receptor Antibody FITC
MBS5400326-02 5x 0.1 mg

Apelin Receptor Antibody FITC

Sign In for Pricing
View Details
Human DDAH2 activation kit by CRISPRa
GA108403 1 Kit

Human DDAH2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Histone-like protein Hq1 (hcbA)
MBS1452469-01 0.02 mg (E-Coli)

Recombinant Coxiella burnetii Histone-like protein Hq1 (hcbA)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Histone-like protein Hq1 (hcbA)
MBS1452469-02 0.1 mg (E-Coli)

Recombinant Coxiella burnetii Histone-like protein Hq1 (hcbA)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Histone-like protein Hq1 (hcbA)
MBS1452469-03 0.02 mg (Yeast)

Recombinant Coxiella burnetii Histone-like protein Hq1 (hcbA)

Sign In for Pricing
View Details