Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2)

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propionaldehyde (>80%)
TRC-P782515-5G 5 g

Propionaldehyde (>80%)

Sign In for Pricing
View Details
TOPBP1 Blocking Peptide
MBS9617666-01 1 mg

TOPBP1 Blocking Peptide

Sign In for Pricing
View Details
TOPBP1 Blocking Peptide
MBS9617666-02 5x 1 mg

TOPBP1 Blocking Peptide

Sign In for Pricing
View Details
Peptide YY (PYY, Peptide Tyrosine Tyrosine, PYY1, PYY-I) (MaxLight 650)
MBS6389061-01 0.1 mL

Peptide YY (PYY, Peptide Tyrosine Tyrosine, PYY1, PYY-I) (MaxLight 650)

Sign In for Pricing
View Details
Peptide YY (PYY, Peptide Tyrosine Tyrosine, PYY1, PYY-I) (MaxLight 650)
MBS6389061-02 5x 0.1 mL

Peptide YY (PYY, Peptide Tyrosine Tyrosine, PYY1, PYY-I) (MaxLight 650)

Sign In for Pricing
View Details
TRAPPC3 (Trafficking protein particle complex subunit 3)
338034 100 µL

TRAPPC3 (Trafficking protein particle complex subunit 3)

Sign In for Pricing
View Details