Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2)

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (FITC)
126280-FITC 100 µL

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (FITC)

Sign In for Pricing
View Details
TOB2 AAV Vector (Human) (CMV)
47275101 1 µg

TOB2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Ccdc97 3'UTR Lenti-reporter-Luc Vector
15335084 1.0 µg

Ccdc97 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mycoplasma Removal Medium (M199)
PM150610-MR 100 mL

Mycoplasma Removal Medium (M199)

Sign In for Pricing
View Details
DUSP1 (Dual Specificity Phosphatase 1, CL100, HVH1, MKP-1, MKP1, PTPN10) (PE)
MBS6186252-01 0.1 mL

DUSP1 (Dual Specificity Phosphatase 1, CL100, HVH1, MKP-1, MKP1, PTPN10) (PE)

Sign In for Pricing
View Details
DUSP1 (Dual Specificity Phosphatase 1, CL100, HVH1, MKP-1, MKP1, PTPN10) (PE)
MBS6186252-02 5x 0.1 mL

DUSP1 (Dual Specificity Phosphatase 1, CL100, HVH1, MKP-1, MKP1, PTPN10) (PE)

Sign In for Pricing
View Details