Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-conjugating enzyme E2 L5 (UB2L5)

This Recombinant Human Ubiquitin-conjugating enzyme E2 L5 (UB2L5) spans the amino acid sequence from region 1-154. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-conjugating enzyme E2 L5; EC 2.3.2.23; Ubiquitin-protein ligase L5; UBE2L5

UniProt

A0A1B0GUS4

Expression Region

1-154

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASRRLMKELEEIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2F2 (NM_001145155) Human Over-expression Lysate
LC428730 20 µg

NR2F2 (NM_001145155) Human Over-expression Lysate

Sign In for Pricing
View Details
RPH3A Antibody
KC-7775-01 50 μL

RPH3A Antibody

Sign In for Pricing
View Details
RPH3A Antibody
KC-7775-02 100 µL

RPH3A Antibody

Sign In for Pricing
View Details
RPH3A Antibody
KC-7775-03 1 mL

RPH3A Antibody

Sign In for Pricing
View Details
Recombinant VCL Antibody
RC-6790-01 50 μL

Recombinant VCL Antibody

Sign In for Pricing
View Details
Recombinant VCL Antibody
RC-6790-02 100 µL

Recombinant VCL Antibody

Sign In for Pricing
View Details