Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcipotriene (MC903)
S3739-100mg 100 mg

Calcipotriene (MC903)

Sign In for Pricing
View Details
MTF1 (Metal-Regulatory Transcription Factor 1, MGC23036, MTF-1, ZRF) (APC)
248999-APC 100 µL

MTF1 (Metal-Regulatory Transcription Factor 1, MGC23036, MTF-1, ZRF) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 2F11/2) [mFluor Violet 500 SE]
NBP2-50375MFV500 0.1 mL

Mouse Monoclonal Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 2F11/2) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Guanylate kinase (GUK1) Human Gene Knockout Kit (CRISPR)
KN402510 1 Kit

Guanylate kinase (GUK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COMMD10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8181R-BF594 100 µL

COMMD10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
SNAI3 Rabbit Polyclonal Antibody
orb631354-01 50 µg

SNAI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details