Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefmetazole (USP grade powder)
51R-U097782 200 mg

Cefmetazole (USP grade powder)

Sign In for Pricing
View Details
TMEM89 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2394707 1.0 µg DNA

TMEM89 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
VU 0364770
C17111-01 10 mM / 1 mL

VU 0364770

Sign In for Pricing
View Details
VU 0364770
C17111-02 50 mg

VU 0364770

Sign In for Pricing
View Details
Rabbit Monoclonal Transcobalamin II Antibody (049) [HRP]
NBP2-89597H 0.1 mL

Rabbit Monoclonal Transcobalamin II Antibody (049) [HRP]

Sign In for Pricing
View Details
Boc-D-Dap(Fmoc)-OH
A-4235.0005 5.0g

Boc-D-Dap(Fmoc)-OH

Sign In for Pricing
View Details