Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CX3CL1/Fractalkine MAb (Clone 96834)
MAB537 500 µg

Rat CX3CL1/Fractalkine MAb (Clone 96834)

Sign In for Pricing
View Details
UCKL1 Double Nickase Plasmid (h2)
sc-409981-NIC-2 20 µg

UCKL1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
MIR362 Rat MicroRNA Expression Plasmid (MI0012590)
SC403374 10 µg

MIR362 Rat MicroRNA Expression Plasmid (MI0012590)

Sign In for Pricing
View Details
Mouse Monoclonal ErbB2/Her2 Antibody (rERBB2/9401) [Janelia Fluor 549]
NBP3-24036JF549 0.1 mL

Mouse Monoclonal ErbB2/Her2 Antibody (rERBB2/9401) [Janelia Fluor 549]

Sign In for Pricing
View Details
PRP6 Rabbit Polyclonal Antibody
E28PT3865 100 µL

PRP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UU-T01
MBS3601740-01 5 mg

UU-T01

Sign In for Pricing
View Details