Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78)

This Recombinant Human T cell receptor beta variable 7-8 (TVB78) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-17/IL-17A Antibody (41802) [DyLight 488]
FAB3171K 0.1 mL

Mouse Monoclonal IL-17/IL-17A Antibody (41802) [DyLight 488]

Sign In for Pricing
View Details
GRB14 Lentiviral Activation Particles (m2)
sc-424532-LAC-2 200 µL

GRB14 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Paraoxonase 2 Antibody / PON2
F54835-0.4ML 0.4 mL

Paraoxonase 2 Antibody / PON2

Sign In for Pricing
View Details
hsa-miR-377 miRNA Antagomir
MNH02083 2x 5.0 nmol

hsa-miR-377 miRNA Antagomir

Sign In for Pricing
View Details
Mouse Monoclonal MTMR14 Antibody (OTI6B6)
NBP2-03077 0.1 mL

Mouse Monoclonal MTMR14 Antibody (OTI6B6)

Sign In for Pricing
View Details
Cyclin B1, Phosphorylated (S147) (CCNB1, CCNB) (PE)
MBS6413339-01 0.1 mL

Cyclin B1, Phosphorylated (S147) (CCNB1, CCNB) (PE)

Sign In for Pricing
View Details