Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO3A Antibody
AF6772-01 100 µL

FOXO3A Antibody

Sign In for Pricing
View Details
FOXO3A Antibody
AF6772-02 200 µL

FOXO3A Antibody

Sign In for Pricing
View Details
Chicken MSTN / Growth/differentiation factor 8 Recombinant Protein
R1653c 1 Each

Chicken MSTN / Growth/differentiation factor 8 Recombinant Protein

Sign In for Pricing
View Details
ADO AAV Vector (Rat) (CMV)
11433106 1 µg

ADO AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Bovine 11beta-Hydroxysteroid Dehydrogenase 2 ELISA Kit
OM623510 96 Strip Well

Bovine 11beta-Hydroxysteroid Dehydrogenase 2 ELISA Kit

Sign In for Pricing
View Details
Integrin alpha 4/ITGA4 Rabbit Polyclonal Antibody (Cy3)
orb2620124 100 µg

Integrin alpha 4/ITGA4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details