Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid A (SAA/326), CF740 conjugate, 0.1mg/mL
BNC740326-500 1x 500 µL

Serum Amyloid A (SAA/326), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycerol-d5 1-Acetate (1-Monoacetin-d5)
451291-01 2.5 mg

Glycerol-d5 1-Acetate (1-Monoacetin-d5)

Sign In for Pricing
View Details
Glycerol-d5 1-Acetate (1-Monoacetin-d5)
451291-02 5 mg

Glycerol-d5 1-Acetate (1-Monoacetin-d5)

Sign In for Pricing
View Details
7-Propargylamino-7-deaza-ddGTP-6-FAM
NU-1618-6FM 120 µL

7-Propargylamino-7-deaza-ddGTP-6-FAM

Sign In for Pricing
View Details
Cnp Mouse Gene Knockout Kit (CRISPR)
KN503567 1 Kit

Cnp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hsa-miR-107 miRNA Agomir
orb1921514-01 5 nmol

Hsa-miR-107 miRNA Agomir

Sign In for Pricing
View Details