Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPI1 Polyclonal Antibody
RD252113A-01 20 µL

SPI1 Polyclonal Antibody

Sign In for Pricing
View Details
SPI1 Polyclonal Antibody
RD252113A-02 60 μL

SPI1 Polyclonal Antibody

Sign In for Pricing
View Details
SPI1 Polyclonal Antibody
RD252113A-03 120 μL

SPI1 Polyclonal Antibody

Sign In for Pricing
View Details
SPI1 Polyclonal Antibody
RD252113A-04 200 µL

SPI1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC29A3 Rabbit pAb
E45R18001N-50 50 µL

SLC29A3 Rabbit pAb

Sign In for Pricing
View Details
(R) -3-Amino-4- (naphthalen-2-yl) butanoic acid hydrochloride
OR1059593-01 100 mg

(R) -3-Amino-4- (naphthalen-2-yl) butanoic acid hydrochloride

Sign In for Pricing
View Details