Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM11 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-18435R-BF594 100 µL

LSM11 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Ac-Phe-3,5-diI-Tyr-OH
sc-284900 250 mg

Ac-Phe-3,5-diI-Tyr-OH

Sign In for Pricing
View Details
IL25 Antibody (Center)
orb1935600-01 50 µL

IL25 Antibody (Center)

Sign In for Pricing
View Details
IL25 Antibody (Center)
orb1935600-02 100 µL

IL25 Antibody (Center)

Sign In for Pricing
View Details
[KO Validated] DDX58 Rabbit pAb
E45R24150N 50 ul

[KO Validated] DDX58 Rabbit pAb

Sign In for Pricing
View Details
(3S,10R,13R,17R) -17-[ (1R) -1,5-Dimethyl-4-methylene-hexyl]-10,13-dimethyl-2,3,4,9,11,12,14,15,16,17-decahydro-1H-cyclopenta[A]phe
YAA58283 1 mg

(3S,10R,13R,17R) -17-[ (1R) -1,5-Dimethyl-4-methylene-hexyl]-10,13-dimethyl-2,3,4,9,11,12,14,15,16,17-decahydro-1H-cyclopenta[A]phe

Sign In for Pricing
View Details