Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72)

This Recombinant Human T cell receptor beta variable 7-2 (TVB72) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA11P sgRNA CRISPR Lentivector (Human) (Target 2)
K0577603 1.0 µg DNA

DEFA11P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant American house dust mite Der f 1/DERF1 Protein, C-His
E55P4124 50 µg

Recombinant American house dust mite Der f 1/DERF1 Protein, C-His

Sign In for Pricing
View Details
Rabbit Polyclonal RABEP2 Antibody
NBP2-13195 0.1 mL

Rabbit Polyclonal RABEP2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (MBS-12) - Azide and BSA Free
NBP2-48015-0.1mg 0.1 mg

Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (MBS-12) - Azide and BSA Free

Sign In for Pricing
View Details
CCDC43 (NM_144609) Human Tagged Lenti ORF Clone
RC211896L4 10 µg

CCDC43 (NM_144609) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tgif2lx1 ORF Vector (Mouse) (pORF)
46603014 1.0 µg DNA

Tgif2lx1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details