Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional regulator PINT87aa (PNT87)

This Recombinant Human Transcriptional regulator PINT87aa (PNT87) spans the amino acid sequence from region 1-87. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transcriptional regulator PINT87aa LINC-PINT

UniProt

A0A455ZAR2

Expression Region

1-87

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gag Rabbit Monoclonal Antibody [Clone R4B3]
E45R11193V-2 50 µL

Gag Rabbit Monoclonal Antibody [Clone R4B3]

Sign In for Pricing
View Details
pMK231 (AAVS1 CMV-MCS-Puro) Plasmid
PVT27340 2 µg

pMK231 (AAVS1 CMV-MCS-Puro) Plasmid

Sign In for Pricing
View Details
Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit
MBS2884422-01 48 Well

Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit
MBS2884422-02 96 Well

Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit
MBS2884422-03 5x 96 Well

Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit
MBS2884422-04 10x 96 Well

Bovine Interleukin-1 receptor-associated kinase 1 ELISA Kit

Sign In for Pricing
View Details