Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9)

This Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9) spans the amino acid sequence from region 1-314. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 9 TSPY9 TSPY9P

UniProt

A0A494C1R9

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki67 HDR Plasmid (m2)
sc-421656-HDR-2 20 µg

Ki67 HDR Plasmid (m2)

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-01 1 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-02 2 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-03 5 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
3 (R, S) -Hydroxy desogestrel
279075-04 10 mg

3 (R, S) -Hydroxy desogestrel

Sign In for Pricing
View Details
Glucokinase (Mouse) ELISA Kit
E4598-100 100 Assays

Glucokinase (Mouse) ELISA Kit

Sign In for Pricing
View Details