Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9)

This Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9) spans the amino acid sequence from region 1-314. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 9 TSPY9 TSPY9P

UniProt

A0A494C1R9

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDXK, NT (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (Azide free) (HRP) discontinued
P3129-09N-HRP 200 µL

PDXK, NT (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1010011-01 0.02 mg (E-Coli)

Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1010011-02 0.1 mg (E-Coli)

Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1010011-03 0.02 mg (Yeast)

Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1010011-04 0.1 mg (Yeast)

Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
MBS1010011-05 0.02 mg (Baculovirus)

Recombinant Natranaerobius thermophilus (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing
View Details