Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41)

This Recombinant Human T cell receptor beta variable 4-1 (TVB41) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN3 Recombinant Antibody, Cy5 Conjugated
bsm-62289R-Cy5-01 20 µL

DCTN3 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
DCTN3 Recombinant Antibody, Cy5 Conjugated
bsm-62289R-Cy5-02 100 µL

DCTN3 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Human IFN gamma Protein
E2PD201081 20 µg

Human IFN gamma Protein

Sign In for Pricing
View Details
Vcp (NM_009503) Mouse Recombinant Protein
TP510760 20 µg

Vcp (NM_009503) Mouse Recombinant Protein

Sign In for Pricing
View Details
Acetylthiocholine Iodide
TRC-A164610-5G 5 g

Acetylthiocholine Iodide

Sign In for Pricing
View Details
Ehd4 Mouse shRNA Plasmid (Locus ID 98878)
TR505563 1 Kit

Ehd4 Mouse shRNA Plasmid (Locus ID 98878)

Sign In for Pricing
View Details