Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51)

This Recombinant Human T cell receptor beta variable 5-1 (TVB51) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epon® Resin 1001F
24305-500 500 g

Epon® Resin 1001F

Sign In for Pricing
View Details
Rabbit Anti-KDM4B antibody
SL12198R-01 50 µL

Rabbit Anti-KDM4B antibody

Sign In for Pricing
View Details
Rabbit Anti-KDM4B antibody
SL12198R-02 100 µL

Rabbit Anti-KDM4B antibody

Sign In for Pricing
View Details
Human CCR6 MAb (Clone 53103R)
MAB195R-SP 25 µg

Human CCR6 MAb (Clone 53103R)

Sign In for Pricing
View Details
Lentiviral human UPF3A shRNA (UAS) - Lentiviral human UPF3A shRNA (UAS, RFP) plasmid
GTR15119677 1 Vial

Lentiviral human UPF3A shRNA (UAS) - Lentiviral human UPF3A shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PPNK, CT (Poly (P) /ATP NAD Kinase, NAD Kinase, NADK) (MaxLight 650) discontinued
P5510-30A-ML650 100 µL

PPNK, CT (Poly (P) /ATP NAD Kinase, NAD Kinase, NADK) (MaxLight 650) discontinued

Sign In for Pricing
View Details