Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2)

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromoxynil (Benzene-13C6)
TRC-B689177-5MG 5 mg

Bromoxynil (Benzene-13C6)

Sign In for Pricing
View Details
RAB32 (NM_006834) Human Recombinant Protein
E45H40527M5 20 µg

RAB32 (NM_006834) Human Recombinant Protein

Sign In for Pricing
View Details
BBOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E11]
TA505731BM 100 µL

BBOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E11]

Sign In for Pricing
View Details
Chicken Iron-sulfur cluster assembly 1 homolog, mitochondrial, ISCA1 ELISA Kit
MBS9329037 Inquire

Chicken Iron-sulfur cluster assembly 1 homolog, mitochondrial, ISCA1 ELISA Kit

Sign In for Pricing
View Details
THEMIS AAV Vector (Mouse) (CMV)
46652104 1 µg

THEMIS AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
ADCY4, ID (ADCY4, Adenylate cyclase type 4, ATP pyrophosphate-lyase 4, Adenylate cyclase type IV, Adenylyl cyclase 4) (PE) discontinued
031628-PE 200 µL

ADCY4, ID (ADCY4, Adenylate cyclase type 4, ATP pyrophosphate-lyase 4, Adenylate cyclase type IV, Adenylyl cyclase 4) (PE) discontinued

Sign In for Pricing
View Details