Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2)

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lnpk (NM_001110209) Mouse Tagged ORF Clone
MG218949 10 µg

Lnpk (NM_001110209) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS814431 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Rat Rhobtb1 Pre-designed siRNA Set B
SI211896B 1 Each

Rat Rhobtb1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
COG8 Antibody, Biotin conjugated
A64382-50UG 50 µg

COG8 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MIF peptide
orb339603-01 1 mg

MIF peptide

Sign In for Pricing
View Details
MIF peptide
orb339603-02 5 mg

MIF peptide

Sign In for Pricing
View Details