Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43)

This Recombinant Human T cell receptor beta variable 4-3 (TVB43) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMMECR1 (NM_015365) Human Over-expression Lysate
LC414594 20 µg

AMMECR1 (NM_015365) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-MRP3/ABCC3 Antibody Picoband®, HRP Conjugate
A02429-1-HRP 100 µg/Vial

Anti-MRP3/ABCC3 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
CPA2 (B-8) : m-IgGκ BP-HRP Bundle
sc-535866 1 Kit

CPA2 (B-8) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Coiled-coil domain-containing protein 162 (C6orf184) Human ELISA Kit
C4703 96 Tests

Coiled-coil domain-containing protein 162 (C6orf184) Human ELISA Kit

Sign In for Pricing
View Details
3- (4-Fluorophenyl) -5-methoxypyridine
422882-01 25 mg

3- (4-Fluorophenyl) -5-methoxypyridine

Sign In for Pricing
View Details
3- (4-Fluorophenyl) -5-methoxypyridine
422882-02 50 mg

3- (4-Fluorophenyl) -5-methoxypyridine

Sign In for Pricing
View Details