Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-8 (TVB58)

This Recombinant Human T cell receptor beta variable 5-8 (TVB58) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-8 TRBV5-8 TCRBV5S4A2T

UniProt

A0A5A2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Protein disulfide-isomerase A4
E10495b 96 Tests

ELISA Kit For Protein disulfide-isomerase A4

Sign In for Pricing
View Details
Porcine Bone Morphogenetic Protein 7 (BMP7) ELISA Kit-Sandwich
EK9F50-01 48 Test

Porcine Bone Morphogenetic Protein 7 (BMP7) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Bone Morphogenetic Protein 7 (BMP7) ELISA Kit-Sandwich
EK9F50-02 96 Tests

Porcine Bone Morphogenetic Protein 7 (BMP7) ELISA Kit-Sandwich

Sign In for Pricing
View Details
C16orf80 Polyclonal Conjugated Antibody
orb1626302 100 µL

C16orf80 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal B7-H4 Antibody (2582H) [PE]
FAB21542P 0.1 mL

Rabbit Monoclonal B7-H4 Antibody (2582H) [PE]

Sign In for Pricing
View Details
Anti-TMEM232 Antibody Picoband® Fluoro550 Conjugated
A17241-1-Fluoro550 100 µg/Vial

Anti-TMEM232 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details