Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-3 (TVBK3)

This Recombinant Human T cell receptor beta variable 11-3 (TVBK3) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-3 TRBV11-3 TCRBV21S2A2

UniProt

A0A5A6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYLQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAD1 siRNA (Rat)
orb1829525-01 15 nmol

ADAD1 siRNA (Rat)

Sign In for Pricing
View Details
ADAD1 siRNA (Rat)
orb1829525-02 30 nmol

ADAD1 siRNA (Rat)

Sign In for Pricing
View Details
Phospho-P38 MAPK (T180) Recombinant Antibody, FITC Conjugated
bsm-63316R-FITC 100 µL

Phospho-P38 MAPK (T180) Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal RHCE Antibody
NBP1-69668 100 µL

Rabbit Polyclonal RHCE Antibody

Sign In for Pricing
View Details
PRSS53 protein, Human, Recombinant (His)
E51P91731 20 µg

PRSS53 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Hsa-miR-6848-5p miRNA Agomir
CMJ2359-01 5 nmol

Hsa-miR-6848-5p miRNA Agomir

Sign In for Pricing
View Details