Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 28 (TVB28)

This Recombinant Human T cell receptor beta variable 28 (TVB28) spans the amino acid sequence from region 27-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 28 TRBV28 TCRBV3S1

UniProt

A0A5B6

Expression Region

27-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DNA Fragmentation Factor Subunit Beta (DFFB) ELISA Kit
abx514956 96 Well

Mouse DNA Fragmentation Factor Subunit Beta (DFFB) ELISA Kit

Sign In for Pricing
View Details
EdU (5-Ethynyl-2'-deoxyuridine)
S1661-1g 1 g

EdU (5-Ethynyl-2'-deoxyuridine)

Sign In for Pricing
View Details
GIRK2 (KCNJ6) (NM_002240) Human Recombinant Protein
TP310938L 1 mg

GIRK2 (KCNJ6) (NM_002240) Human Recombinant Protein

Sign In for Pricing
View Details
TMCO1 shRNA (m) Lentiviral Particles
sc-154324-V 200 µL

TMCO1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Olr1122 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV629810 1.0 µg DNA

Olr1122 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF)
TP3189-01 1 mg

HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF)

Sign In for Pricing
View Details