Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Cyanide
TRC-Z439500-5G 5 g

Zinc Cyanide

Sign In for Pricing
View Details
Cyanine 7 azide [equivalent to Cy7® azide]
163-AAT 1 mg

Cyanine 7 azide [equivalent to Cy7® azide]

Sign In for Pricing
View Details
N-(Acetyl-d3)-S-allyl-L-cysteine
TRC-A168102-5MG 5 mg

N-(Acetyl-d3)-S-allyl-L-cysteine

Sign In for Pricing
View Details
1,2-Dilinoleoyl-3-palmitoyl-rac-glycerol
TRC-D460615-10MG 10 mg

1,2-Dilinoleoyl-3-palmitoyl-rac-glycerol

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (N/A), CF594 conjugate, 0.1mg/mL
BNC941816-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (N/A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707584 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details