Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Abhd12 Pre-designed siRNA Set A
SI100069A 1 Each

Mouse Abhd12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TMEM199 (Transmembrane Protein 199, TMEM199, C17orf32) (AP) discontinued
302796-AP 200 µL

TMEM199 (Transmembrane Protein 199, TMEM199, C17orf32) (AP) discontinued

Sign In for Pricing
View Details
N- (2-Aminoethyl) -α- (aminomethyl) -α- (3-phenylpropyl) benzenepentanamide Conjugate Acid (1:2) discontinued
456832-01 5 mg

N- (2-Aminoethyl) -α- (aminomethyl) -α- (3-phenylpropyl) benzenepentanamide Conjugate Acid (1:2) discontinued

Sign In for Pricing
View Details
N- (2-Aminoethyl) -α- (aminomethyl) -α- (3-phenylpropyl) benzenepentanamide Conjugate Acid (1:2) discontinued
456832-02 10 mg

N- (2-Aminoethyl) -α- (aminomethyl) -α- (3-phenylpropyl) benzenepentanamide Conjugate Acid (1:2) discontinued

Sign In for Pricing
View Details
Anti-MDMX/MDM4 Antibody Picoband® (FITC Conjugate)
PB9872-FITC 100 µg/Vial

Anti-MDMX/MDM4 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
FKBP7 (FK506 Binding Protein 7, FKBP23, PPIase) (AP)
MBS6417366-01 0.1 mL

FKBP7 (FK506 Binding Protein 7, FKBP23, PPIase) (AP)

Sign In for Pricing
View Details