Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) Monoclonal Antibody (Clone: NKX3.1/3348)
36-2861-20 20 µg

Anti-NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) Monoclonal Antibody (Clone: NKX3.1/3348)

Sign In for Pricing
View Details
Anti-HDAC5 Antibody Picoband® (Dylight488 Conjugate)
A01230-5-Dylight488 100 µg

Anti-HDAC5 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
CCDC84 Antibody (HRP)
orb33720-01 50 µg

CCDC84 Antibody (HRP)

Sign In for Pricing
View Details
CCDC84 Antibody (HRP)
orb33720-02 100 µg

CCDC84 Antibody (HRP)

Sign In for Pricing
View Details
Benchtop Shaking Incubator BSBT-2104
BSBT-2104 1 Unit

Benchtop Shaking Incubator BSBT-2104

Sign In for Pricing
View Details
MMP1 Rabbit Polyclonal Antibody
orb570339 100 µg

MMP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details