Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 3 subunit C-like protein (EIFCL), partial

This Recombinant Human Eukaryotic translation initiation factor 3 subunit C-like protein (EIFCL), partial spans the amino acid sequence from region 674-850. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 3 subunit C-like protein EIF3CL

UniProt

B5ME19

Expression Region

674-850

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACSTD2 Antibody
orb683484 100 µL

TACSTD2 Antibody

Sign In for Pricing
View Details
ZNF484 Antibody
CSB-PA026781LA01HU-01 50 µg

ZNF484 Antibody

Sign In for Pricing
View Details
ZNF484 Antibody
CSB-PA026781LA01HU-02 100 µg

ZNF484 Antibody

Sign In for Pricing
View Details
Recombinant Human SOX2-TAT
P1623-.1 100 µg

Recombinant Human SOX2-TAT

Sign In for Pricing
View Details
EPHB4 Knockout NCI-H1299 Polyclonal Cells
ARG17479 1 Million

EPHB4 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Bromoacetamido-PEG9-ethylcarbamoyl-C12-Boc
orb1988564-01 100 mg

Bromoacetamido-PEG9-ethylcarbamoyl-C12-Boc

Sign In for Pricing
View Details