Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HOXB-AS3 peptide (HAS3P)

This Recombinant Human HOXB-AS3 peptide (HAS3P) spans the amino acid sequence from region 1-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HOXB-AS3 peptide HOXB-AS3

UniProt

C0HLZ6

Expression Region

1-53

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Muscle Phosphofructokinase/PFKM Recombinant Protein
PROTP08237-01 20 µg

Human Muscle Phosphofructokinase/PFKM Recombinant Protein

Sign In for Pricing
View Details
Human Muscle Phosphofructokinase/PFKM Recombinant Protein
PROTP08237-02 500 µg

Human Muscle Phosphofructokinase/PFKM Recombinant Protein

Sign In for Pricing
View Details
Rabbit Monoclonal IL-18 R beta/IL-1 R7/ACPL Antibody (001) [DyLight 650]
NBP2-89314C 0.1 mL

Rabbit Monoclonal IL-18 R beta/IL-1 R7/ACPL Antibody (001) [DyLight 650]

Sign In for Pricing
View Details
AKAP8 Antibody
MBS7121771-01 0.05 mg

AKAP8 Antibody

Sign In for Pricing
View Details
AKAP8 Antibody
MBS7121771-02 0.1 mg

AKAP8 Antibody

Sign In for Pricing
View Details
AKAP8 Antibody
MBS7121771-03 5x 0.1 mg

AKAP8 Antibody

Sign In for Pricing
View Details