Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HOXB-AS3 peptide (HAS3P)

This Recombinant Human HOXB-AS3 peptide (HAS3P) spans the amino acid sequence from region 1-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HOXB-AS3 peptide HOXB-AS3

UniProt

C0HLZ6

Expression Region

1-53

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FBXO39 shRNA (UAS) - Lentiviral human FBXO39 shRNA (UAS, GFP) plasmid
GTR15114658 1 Vial

Lentiviral human FBXO39 shRNA (UAS) - Lentiviral human FBXO39 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
GPR75 Protein Vector (Mouse) (pPB-N-His)
PV186279 500 ng

GPR75 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PCB 193 [CAS:69782-91-8] 100ug/ml in Iso-octane
PCB193K1ZT1 1 mL

PCB 193 [CAS:69782-91-8] 100ug/ml in Iso-octane

Sign In for Pricing
View Details
PHGDH Polyclonal Antibody
ANT-13742-100ug 100 µg

PHGDH Polyclonal Antibody

Sign In for Pricing
View Details
Mouse MFG-E8 MAb (Clone 340614)
MAB2805-100 100 µg

Mouse MFG-E8 MAb (Clone 340614)

Sign In for Pricing
View Details
Efinaconazole Impurity D
RM-E061404-01 10 mg

Efinaconazole Impurity D

Sign In for Pricing
View Details