Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP)

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCG3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43146064 1.0 µg DNA

SCG3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) srp101 Polyclonal Antibody
MBS7182238 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) srp101 Polyclonal Antibody

Sign In for Pricing
View Details
Goniometer base type B1A-R
GB-B1A-R-40 40 Bases

Goniometer base type B1A-R

Sign In for Pricing
View Details
Cat 8-Iso-Prostaglandin ELISA Kit
MBS052369 Inquire

Cat 8-Iso-Prostaglandin ELISA Kit

Sign In for Pricing
View Details
Aamp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10993114 3x 1.0 µg

Aamp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
FAM192A Protein Lysate (Mouse) with C-HA Tag
19888034 100 µg

FAM192A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details