Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial

This Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative dispanin subfamily A member 2d; DSPA2d

UniProt

C9JQL5

Expression Region

1-57

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2B2E Rabbit Polyclonal Antibody
BT-AP10339-01 20 µL

H2B2E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H2B2E Rabbit Polyclonal Antibody
BT-AP10339-02 50 µL

H2B2E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H2B2E Rabbit Polyclonal Antibody
BT-AP10339-03 100 µL

H2B2E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HES5 (NM_001010926) Human Tagged ORF Clone Lentiviral Particle
RC215311L1V 200 µL

HES5 (NM_001010926) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ser-Asn-Thr-Arg
orb2276615-01 1 mg

Ser-Asn-Thr-Arg

Sign In for Pricing
View Details
Ser-Asn-Thr-Arg
orb2276615-02 5 mg

Ser-Asn-Thr-Arg

Sign In for Pricing
View Details