Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metallothionein 1H-like protein 1 (M1BL1)

This Recombinant Human Metallothionein 1H-like protein 1 (M1BL1) spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein 1H-like protein 1 MT1HL1

UniProt

P0DM35

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C17orf58 activation kit by CRISPRa
GA117084 1 Kit

Human C17orf58 activation kit by CRISPRa

Sign In for Pricing
View Details
MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]
TA506012AM 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]

Sign In for Pricing
View Details
Human LRRK2 (G2019S) Protein, His Tag
LK2-H5245-20ug 20 µg

Human LRRK2 (G2019S) Protein, His Tag

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559092 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
LOC389831 Human qPCR Primer Pair (XM_041609)
HP220777 200 Reactions

LOC389831 Human qPCR Primer Pair (XM_041609)

Sign In for Pricing
View Details
(+/-)-ortho-Cotinine
TRC-C725050-5MG 5 mg

(+/-)-ortho-Cotinine

Sign In for Pricing
View Details