Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLIT-ROBO Rho GTPase-activating protein 2B (SRG2B)

This Recombinant Human SLIT-ROBO Rho GTPase-activating protein 2B (SRG2B) spans the amino acid sequence from region 1-458. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLIT-ROBO Rho GTPase-activating protein 2B; SLIT-ROBO Rho GTPase activating protein 2 pseudogene 2; SRGAP2B SRGAP2P2

UniProt

P0DMP2

Expression Region

1-458

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELLQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Connexin 45/GJC1 Antibody (5B9.2) [Alexa Fluor 647]
NBP2-29754AF647 0.1 mL

Mouse Monoclonal Connexin 45/GJC1 Antibody (5B9.2) [Alexa Fluor 647]

Sign In for Pricing
View Details
PRY Human shRNA Lentiviral Particle (Locus ID 9081)
TL310133V 500 µL Each

PRY Human shRNA Lentiviral Particle (Locus ID 9081)

Sign In for Pricing
View Details
BMS-1001 hydrochloride
orb2655775-01 5 mg

BMS-1001 hydrochloride

Sign In for Pricing
View Details
BMS-1001 hydrochloride
orb2655775-02 10 mg

BMS-1001 hydrochloride

Sign In for Pricing
View Details
BMS-1001 hydrochloride
orb2655775-03 25 mg

BMS-1001 hydrochloride

Sign In for Pricing
View Details
BMS-1001 hydrochloride
orb2655775-04 50 mg

BMS-1001 hydrochloride

Sign In for Pricing
View Details