Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1L1 (Aldehyde Dehydrogenase Family 1 Member L1, 10-formyltetrahydrofolate Dehydrogenase, 10-FTHFDH, FTHFD, DKFZp781N0997) (PE)
123198-PE 100 µL

ALDH1L1 (Aldehyde Dehydrogenase Family 1 Member L1, 10-formyltetrahydrofolate Dehydrogenase, 10-FTHFDH, FTHFD, DKFZp781N0997) (PE)

Sign In for Pricing
View Details
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody
orb2327797-01 25 µL

DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody

Sign In for Pricing
View Details
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody
orb2327797-02 100 µL

DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody

Sign In for Pricing
View Details
Human HOXB7 Protein Lysate 20ug
IHUHOXB7PLLY20UG 20 µg

Human HOXB7 Protein Lysate 20ug

Sign In for Pricing
View Details
ARHGAP24, CT (ARHGAP24, FILGAP, Rho GTPase-activating protein 24, Filamin-A-associated RhoGAP, RAC1- and CDC42-specific GTPase-activating protein of 72kD, Rho-type GTPase-activating protein 24, RhoGAP of 73kD, Sarcoma antigen NY-SAR-88, p73RhoGAP) (PE) discontinued
032039-PE 200 µL

ARHGAP24, CT (ARHGAP24, FILGAP, Rho GTPase-activating protein 24, Filamin-A-associated RhoGAP, RAC1- and CDC42-specific GTPase-activating protein of 72kD, Rho-type GTPase-activating protein 24, RhoGAP of 73kD, Sarcoma antigen NY-SAR-88, p73RhoGAP) (PE) discontinued

Sign In for Pricing
View Details
AP2A1 Recombinant Antibody, PE Conjugated
bsm-61729R-PE-TR 20 µL

AP2A1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details