Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK1 C terminal Domain mFc Chimera, Human
Z05214-100 100 µg

DKK1 C terminal Domain mFc Chimera, Human

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3808599-01 48 Well

Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3808599-02 96 Well

Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3808599-03 5x 96 Well

Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit
MBS3808599-04 10x 96 Well

Rat Transforming Growth Factor Alpha (TGF-alpha) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human PTHLH/PTHrP Protein
NBP2-35224-100ug 100 µg

Recombinant Human PTHLH/PTHrP Protein

Sign In for Pricing
View Details