Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL
BNC042988-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-HT-1F Antibody
8C12012-AAT 50 µg

5-HT-1F Antibody

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF568 conjugate, 0.1mg/mL
BNC680823-100 1x 100 µL

P21 / WAF1 (CIP1/823), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ginsenoside Rg3
TRC-G387590-25MG 25 mg

Ginsenoside Rg3

Sign In for Pricing
View Details
N-(Trifluoroacetyl)-L-tryptophan
TRC-T789765-50MG 50 mg

N-(Trifluoroacetyl)-L-tryptophan

Sign In for Pricing
View Details
Ahsa1 Mouse Gene Knockout Kit (CRISPR)
KN501014 1 Kit

Ahsa1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details