Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycidyl Stearate-d5
TRC-G615988-1MG 1 mg

Glycidyl Stearate-d5

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638428 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
4-(1,3,4-Oxadiazol-2-yl)aniline
TRC-O858628-10MG 10 mg

4-(1,3,4-Oxadiazol-2-yl)aniline

Sign In for Pricing
View Details
TIMM50 Human Gene Knockout Kit (CRISPR)
KN224744 1 Kit

TIMM50 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrin beta 4 (ITGB4) Mouse Monoclonal Antibody [Clone ID: 58XB4]
AM33010PU-N 100 µg

Integrin beta 4 (ITGB4) Mouse Monoclonal Antibody [Clone ID: 58XB4]

Sign In for Pricing
View Details
Monobutyl Adipate
TRC-M864840-250MG 250 mg

Monobutyl Adipate

Sign In for Pricing
View Details