Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TINAG (NM_014464) Human Over-expression Lysate
LC402341 20 µg

TINAG (NM_014464) Human Over-expression Lysate

Sign In for Pricing
View Details
ASPA Mouse Monoclonal Antibody [Clone ID: OTI5B8]
CF805223 100 µg

ASPA Mouse Monoclonal Antibody [Clone ID: OTI5B8]

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [A1E5]
EM1901-41 100 µL

CD40 Mouse Monoclonal Antibody [A1E5]

Sign In for Pricing
View Details
Streptavidin, CF®583R
#29086 1x 1 mg

Streptavidin, CF®583R

Sign In for Pricing
View Details
Ezh2 Rabbit Polyclonal Antibody
TA362887 100 µL

Ezh2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIK3R1 Antibody
KC-6436-01 50 μL

PIK3R1 Antibody

Sign In for Pricing
View Details