Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,7-Dichloroquinoline-2,3-dicarboxylic acid diethyl ester
sc-291020 500 mg

5,7-Dichloroquinoline-2,3-dicarboxylic acid diethyl ester

Sign In for Pricing
View Details
FAM111A Antibody
CSB-PA853484LA01HU-01 50 µg

FAM111A Antibody

Sign In for Pricing
View Details
FAM111A Antibody
CSB-PA853484LA01HU-02 100 µg

FAM111A Antibody

Sign In for Pricing
View Details
NEDD8 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3812R-APC-Cy5.5 100 µL

NEDD8 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
SPTLC2 siRNA (Mouse)
orb1845377-01 15 nmol

SPTLC2 siRNA (Mouse)

Sign In for Pricing
View Details
SPTLC2 siRNA (Mouse)
orb1845377-02 30 nmol

SPTLC2 siRNA (Mouse)

Sign In for Pricing
View Details