Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D)

This Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43D IGHV3-43D

UniProt

P0DP04

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,5-Dihydroxynaphthalene-2,6-dicarboxylic Acid
TRC-D159531-500MG 500 mg

1,5-Dihydroxynaphthalene-2,6-dicarboxylic Acid

Sign In for Pricing
View Details
PARVB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H9]
TA505714AM 100 µL

PARVB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H9]

Sign In for Pricing
View Details
Biological Microscope BMIC-207
BMIC-207 1 Unit

Biological Microscope BMIC-207

Sign In for Pricing
View Details
VSV-G-tag Mouse Monoclonal Antibody [E0-G7]
M1510-10 100 µL

VSV-G-tag Mouse Monoclonal Antibody [E0-G7]

Sign In for Pricing
View Details
Butanoic-d7 Acid
TRC-B692237-1G 1 g

Butanoic-d7 Acid

Sign In for Pricing
View Details
Trabectedin
TRC-T703500-10MG 10 mg

Trabectedin

Sign In for Pricing
View Details