Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D)

This Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43D IGHV3-43D

UniProt

P0DP04

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad1 (Ab-187) Antibody
8B0994-AAT 50 µg

Smad1 (Ab-187) Antibody

Sign In for Pricing
View Details
Polystyrene C4 FMP
HB04508008.25G 25 g

Polystyrene C4 FMP

Sign In for Pricing
View Details
UBN2 Rabbit Polyclonal Antibody
TA372064 100 µL

UBN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (rKRT18/1190), Biotin conjugate, 0.1mg/mL
BNCB3217-100 1x 100 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/515), 0.2mg/mL
BNUB0515-500 1x 500 µL

CD79a (IGA/515), 0.2mg/mL

Sign In for Pricing
View Details
FOXO4 pSer197 Rabbit Polyclonal Antibody
AP02424PU-N 100 µL

FOXO4 pSer197 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details