Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DRA) (19-26.1), CF740 conjugate, 0.1mg/mL
BNC741082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DREF (ZBED1) Human Gene Knockout Kit (CRISPR)
KN402011 1 Kit

DREF (ZBED1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-tert-Butylphenol
TRC-B809080-5G 5 g

3-tert-Butylphenol

Sign In for Pricing
View Details
FFPE RNA Purification Kit Dx
Dx25300 50 Preparations

FFPE RNA Purification Kit Dx

Sign In for Pricing
View Details
Phospho-Lamin A + Lamin C (S22) Recombinant Rabbit monoclonal Antibody
HA751409 100 µL

Phospho-Lamin A + Lamin C (S22) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL
BNC940041-500 1x 500 µL

Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details