Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octafluorocyclopentene
TRC-O273120-500MG 500 mg

Octafluorocyclopentene

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), Biotin conjugate, 0.1mg/mL
BNCB1782-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2-Bis(2,4,6-tribromophenoxy)ethane-13C12
TRC-B585428-5MG 5 mg

1,2-Bis(2,4,6-tribromophenoxy)ethane-13C12

Sign In for Pricing
View Details
Recombinant HMGB1 Monoclonal Antibody
E-AB-81436-01 50 µL

Recombinant HMGB1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant HMGB1 Monoclonal Antibody
E-AB-81436-02 100 µL

Recombinant HMGB1 Monoclonal Antibody

Sign In for Pricing
View Details
4-Hydroxy-3-nitrobenzoic acid
TRC-H950843-500MG 500 mg

4-Hydroxy-3-nitrobenzoic acid

Sign In for Pricing
View Details