Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431)

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-Chaconine
TRC-C291810-1MG 1 mg

Alpha-Chaconine

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF640R conjugate, 0.1mg/mL
BNC402981-500 1x 500 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF488A conjugate, 0.1mg/mL
BNC882240-500 1x 500 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Crude Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-P-
L-1800-100 100 mg

Crude Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-P-

Sign In for Pricing
View Details
Vmn1r41 Mouse Gene Knockout Kit (CRISPR)
KN519054 1 Kit

Vmn1r41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin S (CTSS) Human Gene Knockout Kit (CRISPR)
KN401215 1 Kit

Cathepsin S (CTSS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details