Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-8Rβ/CDw128β (Ab-347) Antibody
8B1066-AAT 50 µg

IL-8Rβ/CDw128β (Ab-347) Antibody

Sign In for Pricing
View Details
Polycomb Group Antibody Sampler Kit
HAK21086 1 Kit

Polycomb Group Antibody Sampler Kit

Sign In for Pricing
View Details
MASP1 Antibody
OC-517-01 50 μL

MASP1 Antibody

Sign In for Pricing
View Details
MASP1 Antibody
OC-517-02 100 µL

MASP1 Antibody

Sign In for Pricing
View Details
MASP1 Antibody
OC-517-03 1 mL

MASP1 Antibody

Sign In for Pricing
View Details
TFAP4 (NM_003223) Human Recombinant Protein
TP303773M 100 µg

TFAP4 (NM_003223) Human Recombinant Protein

Sign In for Pricing
View Details