Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRAMEF5 activation kit by CRISPRa
GA117560 1 Kit

Human PRAMEF5 activation kit by CRISPRa

Sign In for Pricing
View Details
PTP epsilon (PTPRE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]
TA500977BM 100 µL

PTP epsilon (PTPRE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
GAS2 (NM_001143830) Human Over-expression Lysate
LY428373 100 µg

GAS2 (NM_001143830) Human Over-expression Lysate

Sign In for Pricing
View Details
HypoGel® 400 FP
SP400110150170.100G 100 g

HypoGel® 400 FP

Sign In for Pricing
View Details
SRC Rabbit Monoclonal Antibody [Clone ID: 23GB6690]
TA425115 100 µL

SRC Rabbit Monoclonal Antibody [Clone ID: 23GB6690]

Sign In for Pricing
View Details
Tide Fluor™ 8WS alkyne [TF8WS alkyne] *Near Infrared Emission*
2307-AAT 1 mg

Tide Fluor™ 8WS alkyne [TF8WS alkyne] *Near Infrared Emission*

Sign In for Pricing
View Details