Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130A (D130A)

This Recombinant Human Beta-defensin 130A (D130A) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130A; Beta-defensin 130; Beta-defensin 30; DEFB-30; Defensin, beta 130; DEFB130A DEFB130 DEFB30

UniProt

P0DP74

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab9a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6942807 1.0 µg DNA

Rab9a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Porcine Concanavalin A ELISA kit
GTR10439087 96 Well

Porcine Concanavalin A ELISA kit

Sign In for Pricing
View Details
PEF1 Rabbit Polyclonal Antibody (Cy5.5)
orb1040415 100 µL

PEF1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
APG4B Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1384R-BF594 100 µL

APG4B Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Flash Lamp Bulbs, Round, MES
2020040/7A 1 Each

Flash Lamp Bulbs, Round, MES

Sign In for Pricing
View Details
Amisyn Polyclonal Antibody
bs-11039R 100 µL

Amisyn Polyclonal Antibody

Sign In for Pricing
View Details