Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

This Recombinant Human Protein POLR1D, isoform 2 (RPC22) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Epimerase Family Protein SDR39U1 (SDR39U1) ELISA Kit
MBS9937068 Inquire

Rabbit Epimerase Family Protein SDR39U1 (SDR39U1) ELISA Kit

Sign In for Pricing
View Details
BD1 (beta Defensin-1) (APC)
B0899-03D-APC 100 µL

BD1 (beta Defensin-1) (APC)

Sign In for Pricing
View Details
Anti-FSD1 Antibody Picoband®
A08672-2-carrier-free 100 µg/Vial

Anti-FSD1 Antibody Picoband®

Sign In for Pricing
View Details
Adiponectin Receptor 2 (ADIPOR2) Antibody
abx230171 100 µg

Adiponectin Receptor 2 (ADIPOR2) Antibody

Sign In for Pricing
View Details
APOBEC3C Antibody (C-Term)
MBS9217307-01 0.05 mL

APOBEC3C Antibody (C-Term)

Sign In for Pricing
View Details
APOBEC3C Antibody (C-Term)
MBS9217307-02 0.2 mL

APOBEC3C Antibody (C-Term)

Sign In for Pricing
View Details